A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10101
Swiss-prot Accession number	Q25683 (Sequence in FASTA format)
Description	Crustacean hyperglycemic hormones precursor [Contains: CHH precursor-related peptide (CPRP); Crustacean hyperglycemic hormone (CHH)].
Source organism	Procambarus clarkii (Red swamp crayfish)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Procambarus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released
Post translational modification	N/A
Function	Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
Protein Length	137 Amino acids
Molecular weight	15264
References	1   Yasuda-Kamatani Y., Yasuda A.; "Crustacean hyperglycemic hormone precursor from Procambarusclarkii."; Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases. 2   Kang W.; Submitted (MAR-1993) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 7821776
Domain Name	Crust_neurohorm
Hormone Name	Crustacean hyperglycemic hormone
Mature Hormone Sequence	QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVVDEYISGVQTV
Position of mature hormone in Pre-Hormone protein	72 Residues from position (64-135)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10138
Swiss-prot Accession number	Q9TWW7 (Sequence in FASTA format)
Description	Pigment-dispersing hormone (PDH).
Source organism	Procambarus clarkii (Red swamp crayfish)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Procambarus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod PDH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas
Protein Length	18 Amino acids
Molecular weight	1942
References	1  PubMed abstract 1823925
Domain Name	Pigment_DH
Hormone Name	Pigment-dispersing hormone
Mature Hormone Sequence	NSELINSILGLPKVMNEA
Position of mature hormone in Pre-Hormone protein	18 Residues from position (1-18)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10652
Swiss-prot Accession number	P55848 (Sequence in FASTA format)
Description	Molt-inhibiting hormone (MIH).
Source organism	Procambarus clarkii (Red swamp crayfish)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Procambarus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops
Protein Length	75 Amino acids
Molecular weight	8658
References	1  PubMed abstract 8901124
Domain Name	Crust_neurohorm
Hormone Name	Molt-inhibiting hormone
Mature Hormone Sequence	RYVFEECPGVMGNRAVHGKVTRVCEDCYNVFRDTDVLAGCRKGCFSSEMFKLCLLAMERVEEFPDFKRWIGILNA
Position of mature hormone in Pre-Hormone protein	75 Residues from position (1-75)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated